SCOPe 2.08: Domain d2o5aa1: 2o5a A:2-114

Lineage for d2o5aa1 (2o5a A:2-114)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.12: Iojap/YbeB-like [160252] (3 proteins)
   Pfam PF02410, probably has evolved a different function; closer relationship to the GrpB-like family

6. Protein Uncharacterized protein BH1328 [160255] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [160256] (1 PDB entry)
   Uniprot Q9KD89 2-114

8. Domain d2o5aa1: 2o5a A:2-114 [148593]
   complexed with mn, so4

Details for d2o5aa1

PDB Entry: 2o5a, 2.7 Å

PDB Description: crystal structure of q9kd89 from bacillus halodurans. northeast structural genomics target bhr21

PDB Compounds: (A:) BH1328 protein

SCOPe Domain Sequences for d2o5aa1:

Sequence, based on SEQRES records:

>d2o5aa1 d.218.1.12 (A:2-114) Uncharacterized protein BH1328 {Bacillus halodurans [TaxId: 86665]}
snqellqlavnavddkkaeqvvalnmkgisliadfflichgnsekqvqaiahelkkvaqe
qgieikrlegyeqarwvlidlgdvvvhvfhkderayynleklwgdaptveleg

Sequence, based on observed residues (ATOM records):

>d2o5aa1 d.218.1.12 (A:2-114) Uncharacterized protein BH1328 {Bacillus halodurans [TaxId: 86665]}
snqellqlavnavddkkaeqvvalnmkgisldfflichgnsekqvqaiahelkkvaqeqg
ieikrlegyeqarwvlidlgdvvvhvfhkderayynleklwptveleg

Timeline for d2o5aa1:

• d2o5aa1 first appeared in SCOP 1.75
  
• d2o5aa1 appears in SCOPe 2.07