| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.4: BH3980-like [158560] (1 family) ![]() automatically mapped to Pfam PF06304 |
| Family a.69.4.1: BH3980-like [158561] (3 proteins) Pfam PF06304; DUF1048 |
| Protein Uncharacterized protein BH3976 [158566] (1 species) |
| Species Bacillus halodurans [TaxId:86665] [158567] (1 PDB entry) Uniprot Q9K5W1 16-105 |
| Domain d2o4ta1: 2o4t A:16-105 [148590] complexed with peg |
PDB Entry: 2o4t (more details), 1.95 Å
SCOPe Domain Sequences for d2o4ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o4ta1 a.69.4.1 (A:16-105) Uncharacterized protein BH3976 {Bacillus halodurans [TaxId: 86665]}
hvsrveklpkdyqivykeiqkylfkvgpvelnegigllseilgffeegaaagkgvldvtg
tdvaafcdaligdsktyadlyqesiqqhvd
Timeline for d2o4ta1: