Lineage for d2o4ta1 (2o4t A:16-105)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 771914Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 772063Superfamily a.69.4: BH3980-like [158560] (1 family) (S)
  5. 772064Family a.69.4.1: BH3980-like [158561] (3 proteins)
    Pfam PF06304; DUF1048
  6. 772069Protein Uncharacterized protein BH3976 [158566] (1 species)
  7. 772070Species Bacillus halodurans [TaxId:86665] [158567] (1 PDB entry)
    Uniprot Q9K5W1 16-105
  8. 772071Domain d2o4ta1: 2o4t A:16-105 [148590]
    complexed with peg

Details for d2o4ta1

PDB Entry: 2o4t (more details), 1.95 Å

PDB Description: crystal structure of a protein of the duf1048 family with a left- handed superhelix fold (bh3976) from bacillus halodurans at 1.95 a resolution
PDB Compounds: (A:) BH3976 protein

SCOP Domain Sequences for d2o4ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o4ta1 a.69.4.1 (A:16-105) Uncharacterized protein BH3976 {Bacillus halodurans [TaxId: 86665]}
hvsrveklpkdyqivykeiqkylfkvgpvelnegigllseilgffeegaaagkgvldvtg
tdvaafcdaligdsktyadlyqesiqqhvd

SCOP Domain Coordinates for d2o4ta1:

Click to download the PDB-style file with coordinates for d2o4ta1.
(The format of our PDB-style files is described here.)

Timeline for d2o4ta1: