Class b: All beta proteins [48724] (178 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
Protein O-GlcNAcase NagJ [158922] (1 species) pre C-terminal domain |
Species Clostridium perfringens [TaxId:1502] [158923] (3 PDB entries) Uniprot Q0TR53 768-909! Uniprot Q0TR53 774-906 |
Domain d2o4ea1: 2o4e A:24-165 [148583] Other proteins in same PDB: d2o4ea2 |
PDB Entry: 2o4e (more details)
SCOPe Domain Sequences for d2o4ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o4ea1 b.2.2.2 (A:24-165) O-GlcNAcase NagJ {Clostridium perfringens [TaxId: 1502]} klkeaaevtgsvslealeevqvgenlevgvgidelvnaeafaydftlnydenafeyveai sddgvfvnakkiedgkvrvlvssltgeplpakevlakvvlraeakaegsnlsvtnssvgd geglvheiagtektvniiegts
Timeline for d2o4ea1: