Lineage for d2o4ea1 (2o4e A:24-165)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1112569Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1112583Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 1112597Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 1112651Protein O-GlcNAcase NagJ [158922] (1 species)
    pre C-terminal domain
  7. 1112652Species Clostridium perfringens [TaxId:1502] [158923] (3 PDB entries)
    Uniprot Q0TR53 768-909! Uniprot Q0TR53 774-906
  8. 1112655Domain d2o4ea1: 2o4e A:24-165 [148583]

Details for d2o4ea1

PDB Entry: 2o4e (more details)

PDB Description: the solution structure of a protein-protein interaction module from a family 84 glycoside hydrolase of clostridium perfringens
PDB Compounds: (A:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d2o4ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o4ea1 b.2.2.2 (A:24-165) O-GlcNAcase NagJ {Clostridium perfringens [TaxId: 1502]}
klkeaaevtgsvslealeevqvgenlevgvgidelvnaeafaydftlnydenafeyveai
sddgvfvnakkiedgkvrvlvssltgeplpakevlakvvlraeakaegsnlsvtnssvgd
geglvheiagtektvniiegts

SCOPe Domain Coordinates for d2o4ea1:

Click to download the PDB-style file with coordinates for d2o4ea1.
(The format of our PDB-style files is described here.)

Timeline for d2o4ea1: