SCOP 1.75: Domain d2o4ea1: 2o4e A:24-165

Lineage for d2o4ea1 (2o4e A:24-165)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (8 proteins)
   Pfam PF00963

6. Protein O-GlcNAcase NagJ [158922] (1 species)
   pre C-terminal domain

7. Species Clostridium perfringens [TaxId:1502] [158923] (3 PDB entries)
   Uniprot Q0TR53 768-909! Uniprot Q0TR53 774-906

8. Domain d2o4ea1: 2o4e A:24-165 [148583]

Details for d2o4ea1

PDB Entry: 2o4e

PDB Description: the solution structure of a protein-protein interaction module from a family 84 glycoside hydrolase of clostridium perfringens

PDB Compounds: (A:) O-GlcNAcase nagJ

SCOP Domain Sequences for d2o4ea1:

Sequence; same for both SEQRES and ATOM records:

>d2o4ea1 b.2.2.2 (A:24-165) O-GlcNAcase NagJ {Clostridium perfringens [TaxId: 1502]}
klkeaaevtgsvslealeevqvgenlevgvgidelvnaeafaydftlnydenafeyveai
sddgvfvnakkiedgkvrvlvssltgeplpakevlakvvlraeakaegsnlsvtnssvgd
geglvheiagtektvniiegts

Timeline for d2o4ea1:

• d2o4ea1 is new in SCOP 1.75
  
• d2o4ea1 appears in SCOPe 2.01
  
• d2o4ea1 appears in the current release, SCOPe 2.08