SCOPe 2.03: Domain d2o4aa_: 2o4a A:

Lineage for d2o4aa_ (2o4a A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.7: CUT domain [116891] (5 proteins)
   Pfam PF02376

6. Protein automated matches [190367] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187202] (2 PDB entries)

8. Domain d2o4aa_: 2o4a A: [148582]
   automated match to d1ysea1
   protein/DNA complex

Details for d2o4aa_

PDB Entry: 2o4a, 1.75 Å

PDB Description: Crystal Structure of the N-terminal CUT Domain of SATB1 Bound to Matrix Attachment Region DNA

PDB Compounds: (A:) DNA-binding protein SATB1

SCOPe Domain Sequences for d2o4aa_:

Sequence; same for both SEQRES and ATOM records:

>d2o4aa_ a.35.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evsseiyqwvrdelkragisqavfarvafnrtqgllseilrkeedpktasqsllvnlram
qnflqlpeaerdriyqdererslr

Timeline for d2o4aa_:

• d2o4aa_ first appeared in SCOP 1.75, called d2o4aa1
  
• d2o4aa_ appears in SCOPe 2.02
  
• d2o4aa_ appears in SCOPe 2.04
  
• d2o4aa_ appears in the current release, SCOPe 2.08, called d2o4aa2