Lineage for d2o49a2 (2o49 A:370-452)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709677Family a.35.1.7: CUT domain [116891] (5 proteins)
    Pfam PF02376
  6. 2709693Protein automated matches [190367] (2 species)
    not a true protein
  7. 2709694Species Human (Homo sapiens) [TaxId:9606] [187202] (2 PDB entries)
  8. 2709696Domain d2o49a2: 2o49 A:370-452 [148581]
    Other proteins in same PDB: d2o49a3
    automated match to d1ysea1
    protein/DNA complex

Details for d2o49a2

PDB Entry: 2o49 (more details), 2 Å

PDB Description: Crystal Structure of the N-terminal CUT domain of SATB1 Bound to Matrix Attachment Region DNA
PDB Compounds: (A:) DNA-binding protein SATB1

SCOPe Domain Sequences for d2o49a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o49a2 a.35.1.7 (A:370-452) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evsseiyqwvrdelkragisqavfarvafnrtqgllseilrkeedpktasqsllvnlram
qnflqlpeaerdriyqderersl

SCOPe Domain Coordinates for d2o49a2:

Click to download the PDB-style file with coordinates for d2o49a2.
(The format of our PDB-style files is described here.)

Timeline for d2o49a2: