![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.4: BH3980-like [158560] (1 family) ![]() automatically mapped to Pfam PF06304 |
![]() | Family a.69.4.1: BH3980-like [158561] (3 proteins) Pfam PF06304; DUF1048 |
![]() | Protein Hypothetical protein BCE3448 [158562] (1 species) |
![]() | Species Bacillus cereus [TaxId:1396] [158563] (1 PDB entry) Uniprot Q734F7 14-95 |
![]() | Domain d2o3lb_: 2o3l B: [148580] Other proteins in same PDB: d2o3la2 automated match to d2o3la1 complexed with gol, so4 |
PDB Entry: 2o3l (more details), 2.05 Å
SCOPe Domain Sequences for d2o3lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o3lb_ a.69.4.1 (B:) Hypothetical protein BCE3448 {Bacillus cereus [TaxId: 1396]} eykmmmarvaalpedyqfvfkkiqnymwnfsagngmdmlhiqyelidlfeagaaegrqvl ditgedvasfadelvanakty
Timeline for d2o3lb_: