Lineage for d2o3lb_ (2o3l B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717741Superfamily a.69.4: BH3980-like [158560] (1 family) (S)
    automatically mapped to Pfam PF06304
  5. 2717742Family a.69.4.1: BH3980-like [158561] (3 proteins)
    Pfam PF06304; DUF1048
  6. 2717743Protein Hypothetical protein BCE3448 [158562] (1 species)
  7. 2717744Species Bacillus cereus [TaxId:1396] [158563] (1 PDB entry)
    Uniprot Q734F7 14-95
  8. 2717746Domain d2o3lb_: 2o3l B: [148580]
    Other proteins in same PDB: d2o3la2
    automated match to d2o3la1
    complexed with gol, so4

Details for d2o3lb_

PDB Entry: 2o3l (more details), 2.05 Å

PDB Description: crystal structure of a duf1048 protein with a left-handed superhelix fold (bce_3448) from bacillus cereus atcc 10987 at 2.05 a resolution
PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2o3lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o3lb_ a.69.4.1 (B:) Hypothetical protein BCE3448 {Bacillus cereus [TaxId: 1396]}
eykmmmarvaalpedyqfvfkkiqnymwnfsagngmdmlhiqyelidlfeagaaegrqvl
ditgedvasfadelvanakty

SCOPe Domain Coordinates for d2o3lb_:

Click to download the PDB-style file with coordinates for d2o3lb_.
(The format of our PDB-style files is described here.)

Timeline for d2o3lb_: