| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.4: BH3980-like [158560] (1 family) ![]() automatically mapped to Pfam PF06304 |
| Family a.69.4.1: BH3980-like [158561] (3 proteins) Pfam PF06304; DUF1048 |
| Protein Hypothetical protein BCE3448 [158562] (1 species) |
| Species Bacillus cereus [TaxId:1396] [158563] (1 PDB entry) Uniprot Q734F7 14-95 |
| Domain d2o3la1: 2o3l A:14-95 [148579] Other proteins in same PDB: d2o3la2 complexed with gol, so4 |
PDB Entry: 2o3l (more details), 2.05 Å
SCOPe Domain Sequences for d2o3la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o3la1 a.69.4.1 (A:14-95) Hypothetical protein BCE3448 {Bacillus cereus [TaxId: 1396]}
eykmmmarvaalpedyqfvfkkiqnymwnfsagngmdmlhiqyelidlfeagaaegrqvl
ditgedvasfadelvanaktyv
Timeline for d2o3la1: