![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
![]() | Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins) Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain |
![]() | Protein Putative protein NMB1485 [160829] (1 species) |
![]() | Species Neisseria meningitidis [TaxId:487] [160830] (1 PDB entry) Uniprot Q9JYP7 441-516 |
![]() | Domain d2o3ga1: 2o3g A:180-255 [148576] complexed with edo |
PDB Entry: 2o3g (more details), 2.55 Å
SCOPe Domain Sequences for d2o3ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o3ga1 d.145.1.4 (A:180-255) Putative protein NMB1485 {Neisseria meningitidis [TaxId: 487]} esltvegaleyvelapqlnlpqqeedadfhtvaglimeelqtipdvgdfadfhgwrfevv ekegqriervkitklp
Timeline for d2o3ga1: