![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein Splicing factor, arginine/serine-rich 1, SFRS1 [143346] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143347] (3 PDB entries) Uniprot Q07955 1-95 |
![]() | Domain d2o3da1: 2o3d A:107-207 [148572] Other proteins in same PDB: d2o3da2, d2o3da3 automatically matched to d1x4ca1 |
PDB Entry: 2o3d (more details)
SCOPe Domain Sequences for d2o3da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o3da1 d.58.7.1 (A:107-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} aprgrygppsrrsenrvvvsglppsgswqdlkdhmreagdvcyadvyrdgtgvvefvrke dmtyavrkldntkfrshegetayirvkvdgprspsygrsrs
Timeline for d2o3da1: