Lineage for d2o3da1 (2o3d A:107-207)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952294Protein Splicing factor, arginine/serine-rich 1, SFRS1 [143346] (2 species)
  7. 2952295Species Human (Homo sapiens) [TaxId:9606] [143347] (3 PDB entries)
    Uniprot Q07955 1-95
  8. 2952298Domain d2o3da1: 2o3d A:107-207 [148572]
    Other proteins in same PDB: d2o3da2, d2o3da3
    automatically matched to d1x4ca1

Details for d2o3da1

PDB Entry: 2o3d (more details)

PDB Description: structure of human sf2/asf rna recognition motif 2 (rrm2)
PDB Compounds: (A:) Splicing factor, arginine/serine-rich 1

SCOPe Domain Sequences for d2o3da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o3da1 d.58.7.1 (A:107-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}
aprgrygppsrrsenrvvvsglppsgswqdlkdhmreagdvcyadvyrdgtgvvefvrke
dmtyavrkldntkfrshegetayirvkvdgprspsygrsrs

SCOPe Domain Coordinates for d2o3da1:

Click to download the PDB-style file with coordinates for d2o3da1.
(The format of our PDB-style files is described here.)

Timeline for d2o3da1: