SCOPe 2.07: Domain d2o38b_: 2o38 B:

Lineage for d2o38b_ (2o38 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.13: NE1354 [140532] (2 proteins)
   contains extra C-terminal dimerisation arm (beta-strand)
   automatically mapped to Pfam PF13744

6. Protein Hypothetical protein RPA3824 [158469] (1 species)

7. Species Rhodopseudomonas palustris [TaxId:1076] [158470] (1 PDB entry)
   Uniprot Q6N370 28-116

8. Domain d2o38b_: 2o38 B: [148569]
   automated match to d2o38a1
   complexed with acy

Details for d2o38b_

PDB Entry: 2o38, 1.83 Å

PDB Description: putative xre family transcriptional regulator

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2o38b_:

Sequence; same for both SEQRES and ATOM records:

>d2o38b_ a.35.1.13 (B:) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]}
mpdaeerqtklrlayalnavidrarlsqaaaaarlginqpkvsalrnyklegfsverlmt
llnaldqdveivirkkprsraaarisvvaa

Timeline for d2o38b_:

• d2o38b_ first appeared in SCOP 1.75, called d2o38b1
  
• d2o38b_ appears in SCOPe 2.06
  
• d2o38b_ appears in the current release, SCOPe 2.08