SCOPe 2.08: Domain d2o35a1: 2o35 A:2-80

Lineage for d2o35a1 (2o35 A:2-80)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.293: SMc04008-like [158756] (1 superfamily)
   multihelcal; intertwined homodimer; there are 4 core helices in each subunits; contains putative metal ion-binding motif MxxxxxCxxC in the conserved surface site

4. Superfamily a.293.1: SMc04008-like [158757] (2 families)

5. Family a.293.1.1: SMc04008-like [158758] (1 protein)
   Pfam PF06844; DUF1244

6. Protein Hypothetical protein SMc04008 [158759] (1 species)

7. Species Rhizobium meliloti [TaxId:382] [158760] (1 PDB entry)
   Uniprot Q92M60 2-80

8. Domain d2o35a1: 2o35 A:2-80 [148566]
   complexed with mg

Details for d2o35a1

PDB Entry: 2o35, 2.12 Å

PDB Description: Protein of Unknown Function (DUF1244) from Sinorhizobium meliloti

PDB Compounds: (A:) Hypothetical protein DUF1244

SCOPe Domain Sequences for d2o35a1:

Sequence; same for both SEQRES and ATOM records:

>d2o35a1 a.293.1.1 (A:2-80) Hypothetical protein SMc04008 {Rhizobium meliloti [TaxId: 382]}
seispeqrtafeaavfrrllehlrersdvqnidlmnlagfcrnclsnwyreaaeasgvpm
skeesreivygmpyeewrt

Timeline for d2o35a1:

• d2o35a1 first appeared in SCOP 1.75
  
• d2o35a1 appears in SCOPe 2.07