SCOPe 2.06: Domain d2o2xa1: 2o2x A:8-216

Lineage for d2o2xa1 (2o2x A:8-216)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.19: Histidinol phosphatase-like [142177] (3 proteins)
   no insertion subdomains

6. Protein Hypothetical protein Mll2559 [159532] (1 species)

7. Species Mesorhizobium loti [TaxId:381] [159533] (1 PDB entry)
   Uniprot Q98I56 8-216

8. Domain d2o2xa1: 2o2x A:8-216 [148564]
   complexed with gol

Details for d2o2xa1

PDB Entry: 2o2x, 1.5 Å

PDB Description: crystal structure of a putative had-like phosphatase (mll2559) from mesorhizobium loti at 1.50 a resolution

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2o2xa1:

Sequence; same for both SEQRES and ATOM records:

>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]}
phpltepgvwieriggrvfpphlpalfldrdgtinvdtdypsdpaeivlrpqmlpaiata
nragipvvvvtnqsgiargyfgwsafaavngrvlellreegvfvdmvlacayheagvgpl
aipdhpmrkpnpgmlveagkrlaldlqrslivgdkladmqagkraglaqgwlvdgeaavq
pgfairplrdsselgdllaaietlgrdnr

Timeline for d2o2xa1:

• d2o2xa1 first appeared in SCOP 1.75
  
• d2o2xa1 appears in SCOPe 2.05
  
• d2o2xa1 appears in SCOPe 2.07
  
• d2o2xa1 appears in the current release, SCOPe 2.08