Lineage for d2o2xa1 (2o2x A:8-216)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920176Family c.108.1.19: Histidinol phosphatase-like [142177] (3 proteins)
    no insertion subdomains
  6. 2920203Protein Hypothetical protein Mll2559 [159532] (1 species)
  7. 2920204Species Mesorhizobium loti [TaxId:381] [159533] (1 PDB entry)
    Uniprot Q98I56 8-216
  8. 2920205Domain d2o2xa1: 2o2x A:8-216 [148564]
    complexed with gol

Details for d2o2xa1

PDB Entry: 2o2x (more details), 1.5 Å

PDB Description: crystal structure of a putative had-like phosphatase (mll2559) from mesorhizobium loti at 1.50 a resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2o2xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]}
phpltepgvwieriggrvfpphlpalfldrdgtinvdtdypsdpaeivlrpqmlpaiata
nragipvvvvtnqsgiargyfgwsafaavngrvlellreegvfvdmvlacayheagvgpl
aipdhpmrkpnpgmlveagkrlaldlqrslivgdkladmqagkraglaqgwlvdgeaavq
pgfairplrdsselgdllaaietlgrdnr

SCOPe Domain Coordinates for d2o2xa1:

Click to download the PDB-style file with coordinates for d2o2xa1.
(The format of our PDB-style files is described here.)

Timeline for d2o2xa1: