| Class b: All beta proteins [48724] (180 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
| Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
| Protein automated matches [190381] (11 species) not a true protein |
| Species Escherichia coli [TaxId:562] [187229] (8 PDB entries) |
| Domain d2o2lk_: 2o2l K: [148561] automated match to d1b44d_ |
PDB Entry: 2o2l (more details), 2.53 Å
SCOPe Domain Sequences for d2o2lk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o2lk_ b.40.2.1 (K:) automated matches {Escherichia coli [TaxId: 562]}
apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismek
Timeline for d2o2lk_: