Lineage for d2o2lj_ (2o2l J:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2058420Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2058912Protein automated matches [190381] (8 species)
    not a true protein
  7. 2058935Species Escherichia coli [TaxId:562] [187229] (7 PDB entries)
  8. 2058987Domain d2o2lj_: 2o2l J: [148560]
    automated match to d1b44d_

Details for d2o2lj_

PDB Entry: 2o2l (more details), 2.53 Å

PDB Description: crystal structure of human heat-labile enterotoxin in complex with a blood group a antigen analog
PDB Compounds: (J:) heat-labile enterotoxin b chain

SCOPe Domain Sequences for d2o2lj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o2lj_ b.40.2.1 (J:) automated matches {Escherichia coli [TaxId: 562]}
apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismek

SCOPe Domain Coordinates for d2o2lj_:

Click to download the PDB-style file with coordinates for d2o2lj_.
(The format of our PDB-style files is described here.)

Timeline for d2o2lj_: