![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.33: SecB-like [54610] (1 superfamily) beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432 |
![]() | Superfamily d.33.1: SecB-like [54611] (3 families) ![]() |
![]() | Family d.33.1.2: SP1558-like [160154] (2 proteins) Pfam PF06619; DUF1149 |
![]() | Protein Hypothetical protein gbs1413 [160157] (1 species) |
![]() | Species Streptococcus agalactiae [TaxId:1311] [160158] (1 PDB entry) Uniprot Q8E4I8 1-124 |
![]() | Domain d2o2ab2: 2o2a B:1-124 [148551] Other proteins in same PDB: d2o2aa2, d2o2ab3, d2o2ac3, d2o2ad3 automated match to d2o2aa1 |
PDB Entry: 2o2a (more details), 2.1 Å
SCOPe Domain Sequences for d2o2ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o2ab2 d.33.1.2 (B:1-124) Hypothetical protein gbs1413 {Streptococcus agalactiae [TaxId: 1311]} mevireqefvnqyhydarnleweeengtpktnfevtfqlanrdeaakvtsivavlqfviv rdefvisgvisqmahiqgrlinepsefsqdevenlaaplleivkrltyevteialdrpgv tlef
Timeline for d2o2ab2: