Lineage for d2o2ab2 (2o2a B:1-124)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943083Fold d.33: SecB-like [54610] (1 superfamily)
    beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432
  4. 2943084Superfamily d.33.1: SecB-like [54611] (3 families) (S)
  5. 2943105Family d.33.1.2: SP1558-like [160154] (2 proteins)
    Pfam PF06619; DUF1149
  6. 2943106Protein Hypothetical protein gbs1413 [160157] (1 species)
  7. 2943107Species Streptococcus agalactiae [TaxId:1311] [160158] (1 PDB entry)
    Uniprot Q8E4I8 1-124
  8. 2943109Domain d2o2ab2: 2o2a B:1-124 [148551]
    Other proteins in same PDB: d2o2aa2, d2o2ab3, d2o2ac3, d2o2ad3
    automated match to d2o2aa1

Details for d2o2ab2

PDB Entry: 2o2a (more details), 2.1 Å

PDB Description: The crystal structure of a protein of unknown function from Streptococcus agalactiae
PDB Compounds: (B:) Hypothetical protein gbs1413

SCOPe Domain Sequences for d2o2ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o2ab2 d.33.1.2 (B:1-124) Hypothetical protein gbs1413 {Streptococcus agalactiae [TaxId: 1311]}
mevireqefvnqyhydarnleweeengtpktnfevtfqlanrdeaakvtsivavlqfviv
rdefvisgvisqmahiqgrlinepsefsqdevenlaaplleivkrltyevteialdrpgv
tlef

SCOPe Domain Coordinates for d2o2ab2:

Click to download the PDB-style file with coordinates for d2o2ab2.
(The format of our PDB-style files is described here.)

Timeline for d2o2ab2: