![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.21: Acetylacetone-cleaving enzyme-like [159293] (2 proteins) PfamB PB026844 |
![]() | Protein Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 [159294] (1 species) |
![]() | Species Rubrivivax gelatinosus [TaxId:28068] [159295] (1 PDB entry) Uniprot A2SM23 1-144 |
![]() | Domain d2o1qb_: 2o1q B: [148548] automated match to d2o1qa1 complexed with act, cl, pg4, zn |
PDB Entry: 2o1q (more details), 1.5 Å
SCOPe Domain Sequences for d2o1qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o1qb_ b.82.1.21 (B:) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} mlkskikeeyvqmdqvdwkpfpaafstggirwkllhvspemgswtaifdcpagssfaahv hvgpgeyfltkgkmdvrggkaaggdtaiapgygyesanarhdktefpvasefymsflgpl tfvkpdgspiavigwedaqgawaa
Timeline for d2o1qb_: