SCOPe 2.08: Domain d2o1qa1: 2o1q A:1-144

Lineage for d2o1qa1 (2o1q A:1-144)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.21: Acetylacetone-cleaving enzyme-like [159293] (2 proteins)
   PfamB PB026844

6. Protein Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 [159294] (1 species)

7. Species Rubrivivax gelatinosus [TaxId:28068] [159295] (1 PDB entry)
   Uniprot A2SM23 1-144

8. Domain d2o1qa1: 2o1q A:1-144 [148547]
   complexed with act, cl, pg4, zn

Details for d2o1qa1

PDB Entry: 2o1q, 1.5 Å

PDB Description: crystal structure of a putative acetylacetone dioxygenase (mpe_a3659) from methylibium petroleiphilum pm1 at 1.50 a resolution

PDB Compounds: (A:) putative acetyl/propionyl-CoA carboxylase, alpha subunit

SCOPe Domain Sequences for d2o1qa1:

Sequence; same for both SEQRES and ATOM records:

>d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]}
mlkskikeeyvqmdqvdwkpfpaafstggirwkllhvspemgswtaifdcpagssfaahv
hvgpgeyfltkgkmdvrggkaaggdtaiapgygyesanarhdktefpvasefymsflgpl
tfvkpdgspiavigwedaqgawaa

Timeline for d2o1qa1:

• d2o1qa1 first appeared in SCOP 1.75
  
• d2o1qa1 appears in SCOPe 2.07