Lineage for d2o0ma1 (2o0m A:95-341)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529545Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2529546Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2529802Family c.124.1.8: SorC sugar-binding domain-like [159545] (6 proteins)
    Pfam PF04198
  6. 2529818Protein Transcriptional regulator EF1965 [159550] (1 species)
  7. 2529819Species Enterococcus faecalis [TaxId:1351] [159551] (1 PDB entry)
    Uniprot Q833I7 95-341
  8. 2529820Domain d2o0ma1: 2o0m A:95-341 [148543]
    complexed with po4

Details for d2o0ma1

PDB Entry: 2o0m (more details), 1.6 Å

PDB Description: The crystal structure of the putative SorC family transcriptional regulator from Enterococcus faecalis
PDB Compounds: (A:) Transcriptional regulator, SorC family

SCOPe Domain Sequences for d2o0ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o0ma1 c.124.1.8 (A:95-341) Transcriptional regulator EF1965 {Enterococcus faecalis [TaxId: 1351]}
hqiekemtqyfgiqrcivvagdsdiqkkvlsdfgdvltntlnlllpngentiavmggttm
amvaenmgsletekrhnlfvparggigeavsvqansisavmanktggnyralyvpeqlsr
etynsllqepsiqevltlishancvvhsigralhmaarrkmsddemvmlkqknavaesfg
yffdeegkvvykipriglqlknlqeipyvvaiaggktkakairaymknapkqtwlitdea
aaneilk

SCOPe Domain Coordinates for d2o0ma1:

Click to download the PDB-style file with coordinates for d2o0ma1.
(The format of our PDB-style files is described here.)

Timeline for d2o0ma1: