Lineage for d2o02b1 (2o02 B:1-230)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.7: 14-3-3 protein [48445] (1 family) 
Family a.118.7.1: 14-3-3 protein [48446] (4 proteins) Protein zeta isoform [48449] (2 species) Species Cow (Bos taurus) [TaxId:9913] [48450] (5 PDB entries) 
Domain d2o02b1: 2o02 B:1-230 [148542]
automatically matched to d1qjba_
complexed with bez
Details for d2o02b1
PDB Entry: 2o02 (more details), 1.5 Å
PDB Description: phosphorylation independent interactions between 14-3-3 and exoenzyme s: from structure to pathogenesis
PDB Compounds: (B:) 14-3-3 protein zeta/deltaSCOP Domain Sequences for d2o02b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o02b1 a.118.7.1 (B:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts
SCOP Domain Coordinates for d2o02b1:
Click to download the PDB-style file with coordinates for d2o02b1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2o02b1:
- d2o02b1 is new in SCOP 1.75
- d2o02b1 is called d2o02b_ in SCOPe 2.01
- d2o02b1 appears in the current release, SCOPe 2.08, called d2o02b_
View in 3D
