SCOPe 2.08: Domain d2o02b_: 2o02 B:

Lineage for d2o02b_ (2o02 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)
   automatically mapped to Pfam PF00244

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein zeta isoform [48449] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48451] (13 PDB entries)

8. Domain d2o02b_: 2o02 B: [148542]
   automated match to d1qjaa_
   complexed with bez

Details for d2o02b_

PDB Entry: 2o02, 1.5 Å

PDB Description: phosphorylation independent interactions between 14-3-3 and exoenzyme s: from structure to pathogenesis

PDB Compounds: (B:) 14-3-3 protein zeta/delta

SCOPe Domain Sequences for d2o02b_:

Sequence; same for both SEQRES and ATOM records:

>d2o02b_ a.118.7.1 (B:) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts

Timeline for d2o02b_:

• d2o02b_ first appeared in SCOP 1.75, called d2o02b1
  
• d2o02b_ appears in SCOPe 2.07