Lineage for d2nzwc1 (2nzw C:1-349)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1007198Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 1007199Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (12 families) (S)
  5. 1007603Family c.87.1.11: FucT-like [159794] (1 protein)
    Pfam PF00852; Glycosyltransferase family 10 (fucosyltransferase)
  6. 1007604Protein Alpha1,3-fucosyltransferase FucT [159795] (1 species)
  7. 1007605Species Helicobacter pylori [TaxId:210] [159796] (3 PDB entries)
    Uniprot O30511 1-349
  8. 1007611Domain d2nzwc1: 2nzw C:1-349 [148534]
    automatically matched to 2NZW A:1-349
    complexed with so4

Details for d2nzwc1

PDB Entry: 2nzw (more details), 1.9 Å

PDB Description: crystal structure of alpha1,3-fucosyltransferase
PDB Compounds: (C:) Alpha1,3-fucosyltransferase

SCOPe Domain Sequences for d2nzwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nzwc1 c.87.1.11 (C:1-349) Alpha1,3-fucosyltransferase FucT {Helicobacter pylori [TaxId: 210]}
mfqplldayvesasiekmasksppplkiavanwwgdeeikefknsvlyfilsqrytitlh
qnpnefsdlvfgnplgsarkilsyqnakrvfytgenespnfnlfdyaigfdeldfndryl
rmplyydrlhhkaesvndttapyklkdnslyalkkpshcfkekhpnlcavvndesdplkr
gfasfvasnpnapirnafydalnsiepvtgggsvrntlgynvknkneflsqykfnlcfen
tqgygyvtekiidayfshtipiywgspsvakdfnpksfvnvhdfknfdeaidyikylhth
knayldmlyenplntldgkayfyqnlsfkkilaffktilendtiyhdnp

SCOPe Domain Coordinates for d2nzwc1:

Click to download the PDB-style file with coordinates for d2nzwc1.
(The format of our PDB-style files is described here.)

Timeline for d2nzwc1: