SCOP 1.75: Domain d2nzwa1: 2nzw A:1-349

Lineage for d2nzwa1 (2nzw A:1-349)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (11 families)

5. Family c.87.1.11: FucT-like [159794] (1 protein)
   Pfam PF00852; Glycosyltransferase family 10 (fucosyltransferase)

6. Protein Alpha1,3-fucosyltransferase FucT [159795] (1 species)

7. Species Helicobacter pylori [TaxId:210] [159796] (3 PDB entries)
   Uniprot O30511 1-349

8. Domain d2nzwa1: 2nzw A:1-349 [148532]
   complexed with so4

Details for d2nzwa1

PDB Entry: 2nzw, 1.9 Å

PDB Description: crystal structure of alpha1,3-fucosyltransferase

PDB Compounds: (A:) Alpha1,3-fucosyltransferase

SCOP Domain Sequences for d2nzwa1:

Sequence; same for both SEQRES and ATOM records:

>d2nzwa1 c.87.1.11 (A:1-349) Alpha1,3-fucosyltransferase FucT {Helicobacter pylori [TaxId: 210]}
mfqplldayvesasiekmasksppplkiavanwwgdeeikefknsvlyfilsqrytitlh
qnpnefsdlvfgnplgsarkilsyqnakrvfytgenespnfnlfdyaigfdeldfndryl
rmplyydrlhhkaesvndttapyklkdnslyalkkpshcfkekhpnlcavvndesdplkr
gfasfvasnpnapirnafydalnsiepvtgggsvrntlgynvknkneflsqykfnlcfen
tqgygyvtekiidayfshtipiywgspsvakdfnpksfvnvhdfknfdeaidyikylhth
knayldmlyenplntldgkayfyqnlsfkkilaffktilendtiyhdnp

Timeline for d2nzwa1:

• d2nzwa1 is new in SCOP 1.75
  
• d2nzwa1 appears in SCOPe 2.01
  
• d2nzwa1 appears in the current release, SCOPe 2.08