| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
| Family d.58.18.14: TM1266-like [160329] (2 proteins) PfamB PB015436; stand-alone tetrameric protein; there are single beta-sheet dimers, whose beta-sheets are packed in parallel fasion in the tetramer |
| Protein automated matches [190748] (1 species) not a true protein |
| Species Thermotoga maritima [TaxId:243274] [187936] (1 PDB entry) |
| Domain d2nzcd2: 2nzc D:1-81 [148531] Other proteins in same PDB: d2nzca1, d2nzcd3 automated match to d2nzca1 complexed with acy, gol, po4 |
PDB Entry: 2nzc (more details), 1.95 Å
SCOPe Domain Sequences for d2nzcd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nzcd2 d.58.18.14 (D:1-81) automated matches {Thermotoga maritima [TaxId: 243274]}
mekrfyiltivvedrekayrqvnellhnfsedillrvgypvreenmaiiflvlktdndti
galsgklgqisgvrvktvplk
Timeline for d2nzcd2: