SCOPe 2.08: Domain d2nzcd2: 2nzc D:1-81

Lineage for d2nzcd2 (2nzc D:1-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.14: TM1266-like [160329] (2 proteins)
   PfamB PB015436; stand-alone tetrameric protein; there are single beta-sheet dimers, whose beta-sheets are packed in parallel fasion in the tetramer

6. Protein automated matches [190748] (1 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [187936] (1 PDB entry)

8. Domain d2nzcd2: 2nzc D:1-81 [148531]
   Other proteins in same PDB: d2nzca1, d2nzcd3
   automated match to d2nzca1
   complexed with acy, gol, po4

Details for d2nzcd2

PDB Entry: 2nzc, 1.95 Å

PDB Description: The structure of uncharacterized protein TM1266 from Thermotoga maritima.

PDB Compounds: (D:) hypothetical protein

SCOPe Domain Sequences for d2nzcd2:

Sequence; same for both SEQRES and ATOM records:

>d2nzcd2 d.58.18.14 (D:1-81) automated matches {Thermotoga maritima [TaxId: 243274]}
mekrfyiltivvedrekayrqvnellhnfsedillrvgypvreenmaiiflvlktdndti
galsgklgqisgvrvktvplk

Timeline for d2nzcd2:

• d2nzcd2 first appeared in SCOP 1.75, called d2nzcd1
  
• d2nzcd2 appears in SCOPe 2.07