Lineage for d2nz1x_ (2nz1 X:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075371Fold b.116: Viral chemokine binding protein m3 [82045] (1 superfamily)
    consists of two different beta-sandwich domains of partial topological similarity to immunoglobulin-like folds
  4. 2075372Superfamily b.116.1: Viral chemokine binding protein m3 [82046] (1 family) (S)
    automatically mapped to Pfam PF09213
  5. 2075373Family b.116.1.1: Viral chemokine binding protein m3 [82047] (1 protein)
  6. 2075374Protein Viral chemokine binding protein m3 [82048] (1 species)
  7. 2075375Species Murid herpesvirus 4, MuHV-4 [TaxId:33708] [82049] (4 PDB entries)
  8. 2075380Domain d2nz1x_: 2nz1 X: [148526]
    Other proteins in same PDB: d2nz1d_, d2nz1e_, d2nz1y_
    automated match to d1mkfa_

Details for d2nz1x_

PDB Entry: 2nz1 (more details), 2.5 Å

PDB Description: Viral Chemokine Binding Protein M3 From Murine Gammaherpesvirus68 In Complex With The CC-Chemokine CCL2/MCP-1
PDB Compounds: (X:) Hypothetical protein GAMMAHV.M3

SCOPe Domain Sequences for d2nz1x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nz1x_ b.116.1.1 (X:) Viral chemokine binding protein m3 {Murid herpesvirus 4, MuHV-4 [TaxId: 33708]}
hssgvstqsvdlsqikrgdeiqahcltpaetevtecagilkdvlsknlhelqglcnvknk
mgvpwvsveelgqeiitgrlpfpsvggtpvndlvrvlvvaesntpeetpeeefyayvelq
telytfglsddnvvftsdymtvwmidipksyvdvgmltratfleqwpgakvtvmipysst
ftwcgelgaiseesapqpslsarspvcknsarystskfcevdgctaetgmekmslltpfg
gppqqakmntcpcyykysvsplpamdhliladlagldsltspvyvmaayfdsthenpvrp
ssklyhcalqmtshdgvwtstsseqcpirlvegqsqnvlqvrvaptsmpnlvgvslmleg
qqyrleyfgdh

SCOPe Domain Coordinates for d2nz1x_:

Click to download the PDB-style file with coordinates for d2nz1x_.
(The format of our PDB-style files is described here.)

Timeline for d2nz1x_: