SCOPe 2.08: Domain d2nz1b_: 2nz1 B:

Lineage for d2nz1b_ (2nz1 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.116: Viral chemokine binding protein m3 [82045] (1 superfamily)
   consists of two different beta-sandwich domains of partial topological similarity to immunoglobulin-like folds

4. Superfamily b.116.1: Viral chemokine binding protein m3 [82046] (1 family)
   automatically mapped to Pfam PF09213

5. Family b.116.1.1: Viral chemokine binding protein m3 [82047] (1 protein)

6. Protein Viral chemokine binding protein m3 [82048] (1 species)

7. Species Murid herpesvirus 4, MuHV-4 [TaxId:33708] [82049] (4 PDB entries)

8. Domain d2nz1b_: 2nz1 B: [148523]
   Other proteins in same PDB: d2nz1d_, d2nz1e_, d2nz1y_
   automated match to d1mkfa_

Details for d2nz1b_

PDB Entry: 2nz1, 2.5 Å

PDB Description: viral chemokine binding protein m3 from murine gammaherpesvirus68 in complex with the cc-chemokine ccl2/mcp-1

PDB Compounds: (B:) Hypothetical protein GAMMAHV.M3

SCOPe Domain Sequences for d2nz1b_:

Sequence; same for both SEQRES and ATOM records:

>d2nz1b_ b.116.1.1 (B:) Viral chemokine binding protein m3 {Murid herpesvirus 4, MuHV-4 [TaxId: 33708]}
hssgvstqsvdlsqikrgdeiqahcltpaetevtecagilkdvlsknlhelqglcnvknk
mgvpwvsveelgqeiitgrlpfpsvggtpvndlvrvlvvaesntpeetpeeefyayvelq
telytfglsddnvvftsdymtvwmidipksyvdvgmltratfleqwpgakvtvmipysst
ftwcgelgaiseesapqpslsarspvcknsarystskfcevdgctaetgmekmslltpfg
gppqqakmntcpcyykysvsplpamdhliladlagldsltspvyvmaayfdsthenpvrp
ssklyhcalqmtshdgvwtstsseqcpirlvegqsqnvlqvrvaptsmpnlvgvslmleg
qqyrleyfgdh

Timeline for d2nz1b_:

• d2nz1b_ first appeared in SCOP 1.75, called d2nz1b1
  
• d2nz1b_ appears in SCOPe 2.07