Class b: All beta proteins [48724] (174 folds) |
Fold b.116: Viral chemokine binding protein m3 [82045] (1 superfamily) consists of two different beta-sandwich domains of partial topological similarity to immunoglobulin-like folds |
Superfamily b.116.1: Viral chemokine binding protein m3 [82046] (1 family) automatically mapped to Pfam PF09213 |
Family b.116.1.1: Viral chemokine binding protein m3 [82047] (1 protein) |
Protein Viral chemokine binding protein m3 [82048] (1 species) |
Species Murid herpesvirus 4, MuHV-4 [TaxId:33708] [82049] (4 PDB entries) |
Domain d2nz1a_: 2nz1 A: [148522] Other proteins in same PDB: d2nz1d_, d2nz1e_, d2nz1y_ automated match to d1mkfa_ |
PDB Entry: 2nz1 (more details), 2.5 Å
SCOPe Domain Sequences for d2nz1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nz1a_ b.116.1.1 (A:) Viral chemokine binding protein m3 {Murid herpesvirus 4, MuHV-4 [TaxId: 33708]} hssgvstqsvdlsqikrgdeiqahcltpaetevtecagilkdvlsknlhelqglcnvknk mgvpwvsveelgqeiitgrlpfpsvggtpvndlvrvlvvaesntpeetpeeefyayvelq telytfglsddnvvftsdymtvwmidipksyvdvgmltratfleqwpgakvtvmipysst ftwcgelgaiseesapqpslsarspvcknsarystskfcevdgctaetgmekmslltpfg gppqqakmntcpcyykysvsplpamdhliladlagldsltspvyvmaayfdsthenpvrp ssklyhcalqmtshdgvwtstsseqcpirlvegqsqnvlqvrvaptsmpnlvgvslmleg qqyrleyfgdh
Timeline for d2nz1a_: