Lineage for d2nz1a_ (2nz1 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1334386Fold b.116: Viral chemokine binding protein m3 [82045] (1 superfamily)
    consists of two different beta-sandwich domains of partial topological similarity to immunoglobulin-like folds
  4. 1334387Superfamily b.116.1: Viral chemokine binding protein m3 [82046] (1 family) (S)
    automatically mapped to Pfam PF09213
  5. 1334388Family b.116.1.1: Viral chemokine binding protein m3 [82047] (1 protein)
  6. 1334389Protein Viral chemokine binding protein m3 [82048] (1 species)
  7. 1334390Species Murid herpesvirus 4, MuHV-4 [TaxId:33708] [82049] (4 PDB entries)
  8. 1334393Domain d2nz1a_: 2nz1 A: [148522]
    Other proteins in same PDB: d2nz1d_, d2nz1e_, d2nz1y_
    automated match to d1mkfa_

Details for d2nz1a_

PDB Entry: 2nz1 (more details), 2.5 Å

PDB Description: viral chemokine binding protein m3 from murine gammaherpesvirus68 in complex with the cc-chemokine ccl2/mcp-1
PDB Compounds: (A:) Hypothetical protein GAMMAHV.M3

SCOPe Domain Sequences for d2nz1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nz1a_ b.116.1.1 (A:) Viral chemokine binding protein m3 {Murid herpesvirus 4, MuHV-4 [TaxId: 33708]}
hssgvstqsvdlsqikrgdeiqahcltpaetevtecagilkdvlsknlhelqglcnvknk
mgvpwvsveelgqeiitgrlpfpsvggtpvndlvrvlvvaesntpeetpeeefyayvelq
telytfglsddnvvftsdymtvwmidipksyvdvgmltratfleqwpgakvtvmipysst
ftwcgelgaiseesapqpslsarspvcknsarystskfcevdgctaetgmekmslltpfg
gppqqakmntcpcyykysvsplpamdhliladlagldsltspvyvmaayfdsthenpvrp
ssklyhcalqmtshdgvwtstsseqcpirlvegqsqnvlqvrvaptsmpnlvgvslmleg
qqyrleyfgdh

SCOPe Domain Coordinates for d2nz1a_:

Click to download the PDB-style file with coordinates for d2nz1a_.
(The format of our PDB-style files is described here.)

Timeline for d2nz1a_: