Lineage for d2nysa1 (2nys A:3-119)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813565Fold b.136: SspB-like [101737] (1 superfamily)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold
  4. 813566Superfamily b.136.1: SspB-like [101738] (2 families) (S)
  5. 813597Family b.136.1.2: AGR_C_3712p-like [159075] (1 protein)
    Pfam PF07031; DUF1321
  6. 813598Protein Uncharacterized protein AGR_C_3712p [159076] (1 species)
  7. 813599Species Agrobacterium tumefaciens [TaxId:358] [159077] (1 PDB entry)
    Uniprot Q8U561 3-119
  8. 813600Domain d2nysa1: 2nys A:3-119 [148518]
    mutant

Details for d2nysa1

PDB Entry: 2nys (more details), 2.7 Å

PDB Description: x-ray crystal structure of protein agr_c_3712 from agrobacterium tumefaciens. northeast structural genomics consortium target atr88.
PDB Compounds: (A:) AGR_C_3712p

SCOP Domain Sequences for d2nysa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nysa1 b.136.1.2 (A:3-119) Uncharacterized protein AGR_C_3712p {Agrobacterium tumefaciens [TaxId: 358]}
qdhirydilaqdalrgvirkvlgevaatgrlpgdhhffitfltgapgvrisqhlkskyae
qmtiviqhqfwdmkvtetgfeiglsfsdtpeklvipynairgfydpsvnfelefdvp

SCOP Domain Coordinates for d2nysa1:

Click to download the PDB-style file with coordinates for d2nysa1.
(The format of our PDB-style files is described here.)

Timeline for d2nysa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2nysb1