SCOPe 2.08: Domain d2nysa1: 2nys A:3-119

Lineage for d2nysa1 (2nys A:3-119)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.136: SspB-like [101737] (1 superfamily)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold

4. Superfamily b.136.1: SspB-like [101738] (3 families)

5. Family b.136.1.2: AGR_C_3712p-like [159075] (1 protein)
   Pfam PF07031; DUF1321

6. Protein Uncharacterized protein AGR_C_3712p [159076] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [159077] (1 PDB entry)
   Uniprot Q8U561 3-119

8. Domain d2nysa1: 2nys A:3-119 [148518]

Details for d2nysa1

PDB Entry: 2nys, 2.7 Å

PDB Description: x-ray crystal structure of protein agr_c_3712 from agrobacterium tumefaciens. northeast structural genomics consortium target atr88.

PDB Compounds: (A:) AGR_C_3712p

SCOPe Domain Sequences for d2nysa1:

Sequence; same for both SEQRES and ATOM records:

>d2nysa1 b.136.1.2 (A:3-119) Uncharacterized protein AGR_C_3712p {Agrobacterium tumefaciens [TaxId: 358]}
qdhirydilaqdalrgvirkvlgevaatgrlpgdhhffitfltgapgvrisqhlkskyae
qmtiviqhqfwdmkvtetgfeiglsfsdtpeklvipynairgfydpsvnfelefdvp

Timeline for d2nysa1:

• d2nysa1 first appeared in SCOP 1.75
  
• d2nysa1 appears in SCOPe 2.07