Lineage for d2nygd1 (2nyg D:2-269)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 849559Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest
  4. 849560Superfamily c.140.1: TTHA0583/YokD-like [110710] (2 families) (S)
  5. 849567Family c.140.1.2: Aminoglycoside 3-N-acetyltransferase-like [159765] (1 protein)
    Pfam PF02522; CoA-dependent enzymes
  6. 849568Protein Uncharacterized protein YokD [159766] (1 species)
  7. 849569Species Bacillus subtilis [TaxId:1423] [159767] (1 PDB entry)
    Uniprot O32003 2-271
  8. 849572Domain d2nygd1: 2nyg D:2-269 [148516]
    automatically matched to 2NYG A:2-271
    complexed with coa

Details for d2nygd1

PDB Entry: 2nyg (more details), 2.6 Å

PDB Description: crystal structure of yokd protein from bacillus subtilis
PDB Compounds: (D:) YokD protein

SCOP Domain Sequences for d2nygd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nygd1 c.140.1.2 (D:2-269) Uncharacterized protein YokD {Bacillus subtilis [TaxId: 1423]}
lkkivesttfprtkqsitedlkalglkkgmtvlvhsslssigwvnggavaviqalidvvt
eegtivmpsqsvelsdpkewgnppvpeewwdiiresmpaynsnytpttrgmgqivelfrs
ypevkrsnhpnysfvawgkhknkilnqhplefglgeqsplgklyiresyvlllgadfdss
tcfhlaeyripyqkiinrgapiivegkrvwkeykelefreelfqevgqafeaehnmkvgk
vgsancrlfslteavdfaekwfinndsk

SCOP Domain Coordinates for d2nygd1:

Click to download the PDB-style file with coordinates for d2nygd1.
(The format of our PDB-style files is described here.)

Timeline for d2nygd1: