Lineage for d2nygc2 (2nyg C:3-271)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2530622Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest
  4. 2530623Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) (S)
  5. 2530630Family c.140.1.2: Aminoglycoside 3-N-acetyltransferase-like [159765] (1 protein)
    Pfam PF02522; CoA-dependent enzymes
  6. 2530631Protein Uncharacterized protein YokD [159766] (1 species)
  7. 2530632Species Bacillus subtilis [TaxId:1423] [159767] (1 PDB entry)
    Uniprot O32003 2-271
  8. 2530635Domain d2nygc2: 2nyg C:3-271 [148515]
    Other proteins in same PDB: d2nyga2, d2nygc3, d2nygd3
    automated match to d2nyga1
    complexed with coa

Details for d2nygc2

PDB Entry: 2nyg (more details), 2.6 Å

PDB Description: crystal structure of yokd protein from bacillus subtilis
PDB Compounds: (C:) YokD protein

SCOPe Domain Sequences for d2nygc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nygc2 c.140.1.2 (C:3-271) Uncharacterized protein YokD {Bacillus subtilis [TaxId: 1423]}
kkivesttfprtkqsitedlkalglkkgmtvlvhsslssigwvnggavaviqalidvvte
egtivmpsqsvelsdpkewgnppvpeewwdiiresmpaynsnytpttrgmgqivelfrsy
pevkrsnhpnysfvawgkhknkilnqhplefglgeqsplgklyiresyvlllgadfdsst
cfhlaeyripyqkiinrgapiivegkrvwkeykelefreelfqevgqafeaehnmkvgkv
gsancrlfslteavdfaekwfinndskni

SCOPe Domain Coordinates for d2nygc2:

Click to download the PDB-style file with coordinates for d2nygc2.
(The format of our PDB-style files is described here.)

Timeline for d2nygc2: