Lineage for d2nyga1 (2nyg A:2-271)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1189818Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest
  4. 1189819Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) (S)
  5. 1189826Family c.140.1.2: Aminoglycoside 3-N-acetyltransferase-like [159765] (1 protein)
    Pfam PF02522; CoA-dependent enzymes
  6. 1189827Protein Uncharacterized protein YokD [159766] (1 species)
  7. 1189828Species Bacillus subtilis [TaxId:1423] [159767] (1 PDB entry)
    Uniprot O32003 2-271
  8. 1189829Domain d2nyga1: 2nyg A:2-271 [148514]
    complexed with CoA
    complexed with coa
    complexed with coa

Details for d2nyga1

PDB Entry: 2nyg (more details), 2.6 Å

PDB Description: crystal structure of yokd protein from bacillus subtilis
PDB Compounds: (A:) YokD protein

SCOPe Domain Sequences for d2nyga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nyga1 c.140.1.2 (A:2-271) Uncharacterized protein YokD {Bacillus subtilis [TaxId: 1423]}
lkkivesttfprtkqsitedlkalglkkgmtvlvhsslssigwvnggavaviqalidvvt
eegtivmpsqsvelsdpkewgnppvpeewwdiiresmpaynsnytpttrgmgqivelfrs
ypevkrsnhpnysfvawgkhknkilnqhplefglgeqsplgklyiresyvlllgadfdss
tcfhlaeyripyqkiinrgapiivegkrvwkeykelefreelfqevgqafeaehnmkvgk
vgsancrlfslteavdfaekwfinndskni

SCOPe Domain Coordinates for d2nyga1:

Click to download the PDB-style file with coordinates for d2nyga1.
(The format of our PDB-style files is described here.)

Timeline for d2nyga1: