SCOPe 2.08: Domain d2nyga1: 2nyg A:3-271

Lineage for d2nyga1 (2nyg A:3-271)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest

4. Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families)

5. Family c.140.1.2: Aminoglycoside 3-N-acetyltransferase-like [159765] (1 protein)
   Pfam PF02522; CoA-dependent enzymes

6. Protein Uncharacterized protein YokD [159766] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [159767] (1 PDB entry)
   Uniprot O32003 2-271

8. Domain d2nyga1: 2nyg A:3-271 [148514]
   Other proteins in same PDB: d2nyga2, d2nygc3, d2nygd3
   complexed with CoA
   complexed with coa
   complexed with coa

Details for d2nyga1

PDB Entry: 2nyg, 2.6 Å

PDB Description: crystal structure of yokd protein from bacillus subtilis

PDB Compounds: (A:) YokD protein

SCOPe Domain Sequences for d2nyga1:

Sequence; same for both SEQRES and ATOM records:

>d2nyga1 c.140.1.2 (A:3-271) Uncharacterized protein YokD {Bacillus subtilis [TaxId: 1423]}
kkivesttfprtkqsitedlkalglkkgmtvlvhsslssigwvnggavaviqalidvvte
egtivmpsqsvelsdpkewgnppvpeewwdiiresmpaynsnytpttrgmgqivelfrsy
pevkrsnhpnysfvawgkhknkilnqhplefglgeqsplgklyiresyvlllgadfdsst
cfhlaeyripyqkiinrgapiivegkrvwkeykelefreelfqevgqafeaehnmkvgkv
gsancrlfslteavdfaekwfinndskni

Timeline for d2nyga1:

• d2nyga1 first appeared in SCOP 1.75
  
• d2nyga1 appears in SCOPe 2.07