Lineage for d2nyeb1 (2nye B:181-320)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943253Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2943254Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2943255Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2943344Protein Nuclear protein SNF4 [143134] (1 species)
    duplication: comprises four CBS repeats
  7. 2943345Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143135] (3 PDB entries)
    Uniprot P12904 181-265
  8. 2943348Domain d2nyeb1: 2nye B:181-320 [148513]

Details for d2nyeb1

PDB Entry: 2nye (more details), 2.5 Å

PDB Description: crystal structure of the bateman2 domain of yeast snf4
PDB Compounds: (B:) Nuclear protein SNF4

SCOPe Domain Sequences for d2nyeb1:

Sequence, based on SEQRES records: (download)

>d2nyeb1 d.37.1.1 (B:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
thflkipigdlniitqdnmkscqmttpvidviqmltqgrvssvpiidengylinvyeayd
vlglikggiyndlslsvgealmrrsddfegvytctkndklstimdnirkarvhrffvvdd
vgrlvgvltlsdilkyillg

Sequence, based on observed residues (ATOM records): (download)

>d2nyeb1 d.37.1.1 (B:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
thflkipigdlniitqdnmkscqmttpvidviqmltqgrvssvpiidengylinvyeayd
vlgliklslsvgealmrrsytctkndklstimdnirkarvhrffvvddvgrlvgvltlsd
ilkyillg

SCOPe Domain Coordinates for d2nyeb1:

Click to download the PDB-style file with coordinates for d2nyeb1.
(The format of our PDB-style files is described here.)

Timeline for d2nyeb1: