Lineage for d2nxpd1 (2nxp D:197-343)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 883121Fold d.379: Taf5 N-terminal domain-like [160896] (1 superfamily)
    multihelical cluster with a C-terminal beta-alpha(2)-beta motif; one central buried helix; parallel beta-ribbon
  4. 883122Superfamily d.379.1: Taf5 N-terminal domain-like [160897] (1 family) (S)
  5. 883123Family d.379.1.1: Taf5 N-terminal domain-like [160898] (1 protein)
    Pfam PF04494
  6. 883124Protein TAF5 subunit of TFIID [160899] (3 species)
  7. 883131Species Human (Homo sapiens) [TaxId:9606] [160900] (1 PDB entry)
    Uniprot Q15542 195-343
  8. 883135Domain d2nxpd1: 2nxp D:197-343 [148507]
    automatically matched to 2NXP A:195-343
    complexed with ca

Details for d2nxpd1

PDB Entry: 2nxp (more details), 2.17 Å

PDB Description: Structure of NTD2 domain of the human TAF5 subunit of TFIID
PDB Compounds: (D:) Transcription initiation factor TFIID subunit 5

SCOP Domain Sequences for d2nxpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nxpd1 d.379.1.1 (D:197-343) TAF5 subunit of TFIID {Human (Homo sapiens) [TaxId: 9606]}
dvsavlsaynqqgdptmyeeyysglkhfiecsldchraelsqlfyplfvhmylelvynqh
eneaksffekfhgdqecyyqddlrvlssltkkehmkgnetmldfrtskfvlrisrdsyql
lkrhlqekqnnqiwnivqehlyidifd

SCOP Domain Coordinates for d2nxpd1:

Click to download the PDB-style file with coordinates for d2nxpd1.
(The format of our PDB-style files is described here.)

Timeline for d2nxpd1: