![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein Hypothetical protein SCo4506 [159810] (1 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [159811] (1 PDB entry) Uniprot Q9L0T8 6-282 |
![]() | Domain d2nxoc_: 2nxo C: [148502] automated match to d2nxoa1 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2nxo (more details), 2.04 Å
SCOPe Domain Sequences for d2nxoc_:
Sequence, based on SEQRES records: (download)
>d2nxoc_ c.94.1.1 (C:) Hypothetical protein SCo4506 {Streptomyces coelicolor [TaxId: 1902]} rtrprvghiqflnclplywglartgtlldfeltkdtpeklseqlvrgdldigpvtlvefl knaddlvafpdiavgcdgpvmscvivsqvpldrldgarvalgstsrtsvrlaqlllserf gvqpdyytcppdlslmmqeadaavligdaalranmidgprygldvhdlgalwkewtglpf vfavwaarrdyaerepvitrkvheaflasrnlsleevekvaeqaarweafdedtlakyft tldfrfgapqleavtefarrvgpttgfpadvkvellk
>d2nxoc_ c.94.1.1 (C:) Hypothetical protein SCo4506 {Streptomyces coelicolor [TaxId: 1902]} rtrprvghiqflnclplywglartgtlldfeltkdtpeklseqlvrgdldigpvtlvefl knaddlvafpdiavgcdgpvmscvivsqvpldrldgarvalgstsrtsvrlaqlllserf gvqpdyytcppdlslmeadaavligdaalranmidgvhdlgalwkewtglpfvfavwaar rdyaerepvitrkvheaflasrnlsleevekvaeqaarweafdedtlakyfttldfrfga pqleavtefarrvgpttgfpadvkvellk
Timeline for d2nxoc_: