Lineage for d2nxoc_ (2nxo C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914324Protein Hypothetical protein SCo4506 [159810] (1 species)
  7. 2914325Species Streptomyces coelicolor [TaxId:1902] [159811] (1 PDB entry)
    Uniprot Q9L0T8 6-282
  8. 2914328Domain d2nxoc_: 2nxo C: [148502]
    automated match to d2nxoa1
    has additional insertions and/or extensions that are not grouped together

Details for d2nxoc_

PDB Entry: 2nxo (more details), 2.04 Å

PDB Description: crystal structure of protein sco4506 from streptomyces coelicolor, pfam duf178
PDB Compounds: (C:) Hypothetical protein SCO4506

SCOPe Domain Sequences for d2nxoc_:

Sequence, based on SEQRES records: (download)

>d2nxoc_ c.94.1.1 (C:) Hypothetical protein SCo4506 {Streptomyces coelicolor [TaxId: 1902]}
rtrprvghiqflnclplywglartgtlldfeltkdtpeklseqlvrgdldigpvtlvefl
knaddlvafpdiavgcdgpvmscvivsqvpldrldgarvalgstsrtsvrlaqlllserf
gvqpdyytcppdlslmmqeadaavligdaalranmidgprygldvhdlgalwkewtglpf
vfavwaarrdyaerepvitrkvheaflasrnlsleevekvaeqaarweafdedtlakyft
tldfrfgapqleavtefarrvgpttgfpadvkvellk

Sequence, based on observed residues (ATOM records): (download)

>d2nxoc_ c.94.1.1 (C:) Hypothetical protein SCo4506 {Streptomyces coelicolor [TaxId: 1902]}
rtrprvghiqflnclplywglartgtlldfeltkdtpeklseqlvrgdldigpvtlvefl
knaddlvafpdiavgcdgpvmscvivsqvpldrldgarvalgstsrtsvrlaqlllserf
gvqpdyytcppdlslmeadaavligdaalranmidgvhdlgalwkewtglpfvfavwaar
rdyaerepvitrkvheaflasrnlsleevekvaeqaarweafdedtlakyfttldfrfga
pqleavtefarrvgpttgfpadvkvellk

SCOPe Domain Coordinates for d2nxoc_:

Click to download the PDB-style file with coordinates for d2nxoc_.
(The format of our PDB-style files is described here.)

Timeline for d2nxoc_: