Lineage for d2nxob1 (2nxo B:5-280)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846191Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 846192Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 846193Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)
  6. 846575Protein Hypothetical protein SCo4506 [159810] (1 species)
  7. 846576Species Streptomyces coelicolor [TaxId:1902] [159811] (1 PDB entry)
    Uniprot Q9L0T8 6-282
  8. 846578Domain d2nxob1: 2nxo B:5-280 [148501]
    automatically matched to 2NXO A:5-281

Details for d2nxob1

PDB Entry: 2nxo (more details), 2.04 Å

PDB Description: crystal structure of protein sco4506 from streptomyces coelicolor, pfam duf178
PDB Compounds: (B:) Hypothetical protein SCO4506

SCOP Domain Sequences for d2nxob1:

Sequence, based on SEQRES records: (download)

>d2nxob1 c.94.1.1 (B:5-280) Hypothetical protein SCo4506 {Streptomyces coelicolor [TaxId: 1902]}
trprvghiqflnclplywglartgtlldfeltkdtpeklseqlvrgdldigpvtlveflk
naddlvafpdiavgcdgpvmscvivsqvpldrldgarvalgstsrtsvrlaqlllserfg
vqpdyytcppdlslmmqeadaavligdaalranmidgprygldvhdlgalwkewtglpfv
favwaarrdyaerepvitrkvheaflasrnlsleevekvaeqaarweafdedtlakyftt
ldfrfgapqleavtefarrvgpttgfpadvkvellk

Sequence, based on observed residues (ATOM records): (download)

>d2nxob1 c.94.1.1 (B:5-280) Hypothetical protein SCo4506 {Streptomyces coelicolor [TaxId: 1902]}
trprvghiqflnclplywglartgtlldfeltkdtpeklseqlvrgdldigpvtlveflk
naddlvafpdiavgcdgpvmscvivsqvpldrrvalgstsrtsvrlaqlllserpdyytc
ppdlslmeadaavligdaalranmidgprygldvhdlgalwkewtglpfvfavwaarrdy
aerepvitrkvheaflasrnlsleevekvaeqaarweafdedtlakyfttldfrfgapql
eavtefarrvgpttgfpadvkvellk

SCOP Domain Coordinates for d2nxob1:

Click to download the PDB-style file with coordinates for d2nxob1.
(The format of our PDB-style files is described here.)

Timeline for d2nxob1: