SCOPe 2.08: Domain d2nxob_: 2nxo B:

Lineage for d2nxob_ (2nxo B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Hypothetical protein SCo4506 [159810] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [159811] (1 PDB entry)
   Uniprot Q9L0T8 6-282

8. Domain d2nxob_: 2nxo B: [148501]
   automated match to d2nxoa1
   has additional insertions and/or extensions that are not grouped together

Details for d2nxob_

PDB Entry: 2nxo, 2.04 Å

PDB Description: crystal structure of protein sco4506 from streptomyces coelicolor, pfam duf178

PDB Compounds: (B:) Hypothetical protein SCO4506

SCOPe Domain Sequences for d2nxob_:

Sequence, based on SEQRES records:

>d2nxob_ c.94.1.1 (B:) Hypothetical protein SCo4506 {Streptomyces coelicolor [TaxId: 1902]}
trprvghiqflnclplywglartgtlldfeltkdtpeklseqlvrgdldigpvtlveflk
naddlvafpdiavgcdgpvmscvivsqvpldrldgarvalgstsrtsvrlaqlllserfg
vqpdyytcppdlslmmqeadaavligdaalranmidgprygldvhdlgalwkewtglpfv
favwaarrdyaerepvitrkvheaflasrnlsleevekvaeqaarweafdedtlakyftt
ldfrfgapqleavtefarrvgpttgfpadvkvellk

Sequence, based on observed residues (ATOM records):

>d2nxob_ c.94.1.1 (B:) Hypothetical protein SCo4506 {Streptomyces coelicolor [TaxId: 1902]}
trprvghiqflnclplywglartgtlldfeltkdtpeklseqlvrgdldigpvtlveflk
naddlvafpdiavgcdgpvmscvivsqvpldrrvalgstsrtsvrlaqlllserpdyytc
ppdlslmeadaavligdaalranmidgprygldvhdlgalwkewtglpfvfavwaarrdy
aerepvitrkvheaflasrnlsleevekvaeqaarweafdedtlakyfttldfrfgapql
eavtefarrvgpttgfpadvkvellk

Timeline for d2nxob_:

• d2nxob_ first appeared in SCOP 1.75, called d2nxob1
  
• d2nxob_ appears in SCOPe 2.07