Lineage for d2nxfa1 (2nxf A:3-322)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998454Family d.159.1.12: ADPRibase-Mn-like [160880] (1 protein)
    contains Mn2+-dependent ADP-ribose/CDP-alcohol pyrophosphatase (ADPRibase-Mn); part of Pfam PF00149
  6. 2998455Protein Uncharacterized C17orf48 homolog zgc:64213 [160881] (1 species)
  7. 2998456Species Zebrafish (Danio rerio) [TaxId:7955] [160882] (1 PDB entry)
    Uniprot Q7T291 3-322
  8. 2998457Domain d2nxfa1: 2nxf A:3-322 [148499]
    complexed with eoh, po4, zn

Details for d2nxfa1

PDB Entry: 2nxf (more details), 1.7 Å

PDB Description: crystal structure of a dimetal phosphatase from danio rerio loc 393393
PDB Compounds: (A:) Putative dimetal phosphatase

SCOPe Domain Sequences for d2nxfa1:

Sequence, based on SEQRES records: (download)

>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]}
dpvftfgliadvqyadiedgenylrtrrryyrgsadllrdavlqwrrervqcvvqlgdii
dghnrrrdasdraldtvmaeldacsvdvhhvwgnhefynfsrpsllssrlnsaqrtgtdt
gsdligddiyayefspapnfrfvlldaydlsvigreeesekhthswriltqhnhnlqdln
lppvsvgleqrfvkfnggfseqqlqwldavltlsdhkqervlifshlpvhpcaadpicla
wnheavlsvlrshqsvlcfiaghdhdggrctdssgaqhitlegvietpphshafatayly
edrmvmkgrgrvedltitys

Sequence, based on observed residues (ATOM records): (download)

>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]}
dpvftfgliadvqyadiedgenylrtrrryyrgsadllrdavlqwrrervqcvvqlgdii
dghnrrrdasdraldtvmaeldacsvdvhhvwgnhefynfsrpsllssrlnsaqgsdlig
ddiyayefspapnfrfvlldaydlsvigreeesekhthswriltqhnhnlqdlnlppvsv
gleqrfvkfnggfseqqlqwldavltlsdhkqervlifshlpvhpcaadpiclawnheav
lsvlrshqsvlcfiaghdhdggrctdssgaqhitlegvietpphshafataylyedrmvm
kgrgrvedltitys

SCOPe Domain Coordinates for d2nxfa1:

Click to download the PDB-style file with coordinates for d2nxfa1.
(The format of our PDB-style files is described here.)

Timeline for d2nxfa1: