SCOPe 2.08: Domain d2nx2a1: 2nx2 A:2-177

Lineage for d2nx2a1 (2nx2 A:2-177)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567

4. Superfamily c.129.1: MCP/YpsA-like [102405] (6 families)

5. Family c.129.1.2: YpsA-like [159579] (1 protein)
   Pfam PF06908; DUF1273; lacking the last strand 7; different set of conserved residues in the putative active site than in the MoCo carrier protein-like family

6. Protein Hypothetical protein YpsA [159580] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [159581] (1 PDB entry)
   Uniprot P50838 1-177

8. Domain d2nx2a1: 2nx2 A:2-177 [148498]
   Other proteins in same PDB: d2nx2a2

Details for d2nx2a1

PDB Entry: 2nx2, 2 Å

PDB Description: crystal structure of protein ypsa from bacillus subtilis, pfam duf1273

PDB Compounds: (A:) Hypothetical protein ypsA

SCOPe Domain Sequences for d2nx2a1:

Sequence; same for both SEQRES and ATOM records:

>d2nx2a1 c.129.1.2 (A:2-177) Hypothetical protein YpsA {Bacillus subtilis [TaxId: 1423]}
kvlaitgykpfelgifkqddkalyyikkaiknrliafldeglewilisgqlgvelwaaea
aydlqeeypdlkvavitpfyeqeknwkepnkeqyeavlaqadyeaslthrpyesplqfkq
knqffidksdgllllydpekegspkymlgtaekrreqdgypiyfitmddlrvtvee

Timeline for d2nx2a1:

• d2nx2a1 first appeared in SCOP 1.75
  
• d2nx2a1 appears in SCOPe 2.07