Lineage for d2nwub1 (2nwu B:3-143)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865505Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 865506Superfamily d.77.1: RL5-like [55282] (2 families) (S)
  5. 865598Family d.77.1.2: SSO1042-like [160489] (4 proteins)
    Pfam PF01877; DUF54
  6. 865611Protein Hypothetical protein SSo1042 [160490] (1 species)
  7. 865612Species Sulfolobus solfataricus [TaxId:2287] [160491] (1 PDB entry)
    Uniprot Q97Z89 3-144
  8. 865614Domain d2nwub1: 2nwu B:3-143 [148497]
    automatically matched to 2NWU A:3-144

Details for d2nwub1

PDB Entry: 2nwu (more details), 2.4 Å

PDB Description: crystal structure of protein sso1042 from sulfolobus solfataricus, pfam duf54
PDB Compounds: (B:) UPF0201 protein SSO1042

SCOP Domain Sequences for d2nwub1:

Sequence, based on SEQRES records: (download)

>d2nwub1 d.77.1.2 (B:3-143) Hypothetical protein SSo1042 {Sulfolobus solfataricus [TaxId: 2287]}
kvmvvaevrpsedvnkvlsaisnffdfekmntrkegiidilvleartlksllkfhrvlrn
erildsarkylmkgiegntiafmihkqaaavgvlsfvdsdkesplgaikfyieyqnpkei
vdwlapktahgvplwdnpvpp

Sequence, based on observed residues (ATOM records): (download)

>d2nwub1 d.77.1.2 (B:3-143) Hypothetical protein SSo1042 {Sulfolobus solfataricus [TaxId: 2287]}
kvmvvaevrpsedvnkvlsaisnffdfekmntrkegiidilvleartlksllkfhrvlrn
erildsarkylmkgiegntiafmihkqaaavgvlsfvaikfyieyqnpkeivdwlapkta
hgvplwdnpvpp

SCOP Domain Coordinates for d2nwub1:

Click to download the PDB-style file with coordinates for d2nwub1.
(The format of our PDB-style files is described here.)

Timeline for d2nwub1: