Lineage for d2nwtb2 (2nwt B:1-63)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2433284Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
    pseudobarrel; capped on both ends by alpha-helices
  4. 2433340Superfamily b.129.2: AF2212/PG0164-like [141694] (2 families) (S)
    six-stranded barrel, topologically similar to the Reductase/isomerase/elongation factor domain fold (50412)
  5. 2433345Family b.129.2.2: AF2212-like [159360] (2 proteins)
    Pfam PF01954; DUF104; intertwinned homodimer of beta(2)-loop-beta subunits; the capping helices are replaced with extended loops
  6. 2433349Protein automated matches [254615] (1 species)
    not a true protein
  7. 2433350Species Archaeoglobus fulgidus [TaxId:2234] [255513] (1 PDB entry)
  8. 2433351Domain d2nwtb2: 2nwt B:1-63 [148495]
    Other proteins in same PDB: d2nwta1, d2nwta2, d2nwtb3
    automated match to d2nwta1

Details for d2nwtb2

PDB Entry: 2nwt (more details)

PDB Description: nmr structure of protein upf0165 protein af_2212 from archaeoglobus fulgidus; northeast structural genomics consortium target gr83
PDB Compounds: (B:) UPF0165 protein AF_2212

SCOPe Domain Sequences for d2nwtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nwtb2 b.129.2.2 (B:1-63) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mpkiieavyengvfkplqkvdlkegervkiklelkvepidlgepvsveeikkirdgtwms
sle

SCOPe Domain Coordinates for d2nwtb2:

Click to download the PDB-style file with coordinates for d2nwtb2.
(The format of our PDB-style files is described here.)

Timeline for d2nwtb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nwtb3