SCOPe 2.08: Domain d2nwtb2: 2nwt B:1-63

Lineage for d2nwtb2 (2nwt B:1-63)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.129.2: AF2212/PG0164-like [141694] (2 families)
   six-stranded barrel, topologically similar to the Reductase/isomerase/elongation factor domain fold (50412)

5. Family b.129.2.2: AF2212-like [159360] (2 proteins)
   Pfam PF01954; DUF104; intertwinned homodimer of beta(2)-loop-beta subunits; the capping helices are replaced with extended loops

6. Protein automated matches [254615] (1 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [255513] (1 PDB entry)

8. Domain d2nwtb2: 2nwt B:1-63 [148495]
   Other proteins in same PDB: d2nwta1, d2nwta2, d2nwtb3
   automated match to d2nwta1

Details for d2nwtb2

PDB Entry: 2nwt

PDB Description: nmr structure of protein upf0165 protein af_2212 from archaeoglobus fulgidus; northeast structural genomics consortium target gr83

PDB Compounds: (B:) UPF0165 protein AF_2212

SCOPe Domain Sequences for d2nwtb2:

Sequence; same for both SEQRES and ATOM records:

>d2nwtb2 b.129.2.2 (B:1-63) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mpkiieavyengvfkplqkvdlkegervkiklelkvepidlgepvsveeikkirdgtwms
sle

Timeline for d2nwtb2:

• d2nwtb2 first appeared in SCOP 1.75, called d2nwtb1
  
• d2nwtb2 appears in SCOPe 2.07