SCOP 1.75: Domain d2nwta1: 2nwt A:1-61

Lineage for d2nwta1 (2nwt A:1-61)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.129.2: AF2212/PG0164-like [141694] (2 families)
   six-stranded barrel, topologically similar to the Reductase/isomerase/elongation factor domain fold ((50412))

5. Family b.129.2.2: AF2212-like [159360] (1 protein)
   Pfam PF01954; DUF104; intertwinned homodimer of beta(2)-loop-beta subunits; the capping helices are replaced with extended loops

6. Protein Uncharacterized protein AF2212 [159361] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [159362] (1 PDB entry)
   Uniprot O28071 1-61

8. Domain d2nwta1: 2nwt A:1-61 [148494]

Details for d2nwta1

PDB Entry: 2nwt

PDB Description: nmr structure of protein upf0165 protein af_2212 from archaeoglobus fulgidus; northeast structural genomics consortium target gr83

PDB Compounds: (A:) UPF0165 protein AF_2212

SCOP Domain Sequences for d2nwta1:

Sequence; same for both SEQRES and ATOM records:

>d2nwta1 b.129.2.2 (A:1-61) Uncharacterized protein AF2212 {Archaeoglobus fulgidus [TaxId: 2234]}
mpkiieavyengvfkplqkvdlkegervkiklelkvepidlgepvsveeikkirdgtwms
s

Timeline for d2nwta1:

• d2nwta1 is new in SCOP 1.75
  
• d2nwta1 appears in SCOPe 2.01
  
• d2nwta1 appears in the current release, SCOPe 2.08