Lineage for d2nwif_ (2nwi F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611610Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
    duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654
  4. 2611611Superfamily d.190.1: Chorismate lyase-like [64288] (4 families) (S)
  5. 2611679Family d.190.1.3: AF1396-like [160415] (2 proteins)
    Pfam PF01947; DUF98
  6. 2611683Protein automated matches [190745] (1 species)
    not a true protein
  7. 2611684Species Archaeoglobus fulgidus [TaxId:2234] [187930] (1 PDB entry)
  8. 2611689Domain d2nwif_: 2nwi F: [148493]
    Other proteins in same PDB: d2nwia1, d2nwia2, d2nwib3, d2nwic3, d2nwid3, d2nwie3
    automated match to d2nwia1

Details for d2nwif_

PDB Entry: 2nwi (more details), 2.2 Å

PDB Description: crystal structure of protein af1396 from archaeoglobus fulgidus, pfam duf98
PDB Compounds: (F:) hypothetical protein

SCOPe Domain Sequences for d2nwif_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nwif_ d.190.1.3 (F:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
naihrilmttdgsitaiieavtqkkvevetleqkiiradrelaelleidegdevnyrvvy
lrangeiyakaisftplkrlensfredlmradipigkimrkhniearreirwsrveeadl
alakelgiadrrvisrnyniihrgkvliniteffpmerf

SCOPe Domain Coordinates for d2nwif_:

Click to download the PDB-style file with coordinates for d2nwif_.
(The format of our PDB-style files is described here.)

Timeline for d2nwif_: