Lineage for d2nwif1 (2nwi F:2-160)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879760Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
    duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654
  4. 879761Superfamily d.190.1: Chorismate lyase-like [64288] (3 families) (S)
  5. 879827Family d.190.1.3: AF1396-like [160415] (1 protein)
    Pfam PF01947; DUF98
  6. 879828Protein Hypothetical protein AF1396 [160416] (1 species)
  7. 879829Species Archaeoglobus fulgidus [TaxId:2234] [160417] (1 PDB entry)
    Uniprot O28875 1-160
  8. 879835Domain d2nwif1: 2nwi F:2-160 [148493]
    automatically matched to 2NWI A:1-160

Details for d2nwif1

PDB Entry: 2nwi (more details), 2.2 Å

PDB Description: crystal structure of protein af1396 from archaeoglobus fulgidus, pfam duf98
PDB Compounds: (F:) hypothetical protein

SCOP Domain Sequences for d2nwif1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nwif1 d.190.1.3 (F:2-160) Hypothetical protein AF1396 {Archaeoglobus fulgidus [TaxId: 2234]}
naihrilmttdgsitaiieavtqkkvevetleqkiiradrelaelleidegdevnyrvvy
lrangeiyakaisftplkrlensfredlmradipigkimrkhniearreirwsrveeadl
alakelgiadrrvisrnyniihrgkvliniteffpmerf

SCOP Domain Coordinates for d2nwif1:

Click to download the PDB-style file with coordinates for d2nwif1.
(The format of our PDB-style files is described here.)

Timeline for d2nwif1: