Lineage for d2nwie2 (2nwi E:2-160)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005715Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
    duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654
  4. 3005716Superfamily d.190.1: Chorismate lyase-like [64288] (4 families) (S)
  5. 3005784Family d.190.1.3: AF1396-like [160415] (2 proteins)
    Pfam PF01947; DUF98
  6. 3005788Protein automated matches [190745] (1 species)
    not a true protein
  7. 3005789Species Archaeoglobus fulgidus [TaxId:2234] [187930] (1 PDB entry)
  8. 3005793Domain d2nwie2: 2nwi E:2-160 [148492]
    Other proteins in same PDB: d2nwia1, d2nwia2, d2nwib3, d2nwic3, d2nwid3, d2nwie3
    automated match to d2nwia1

Details for d2nwie2

PDB Entry: 2nwi (more details), 2.2 Å

PDB Description: crystal structure of protein af1396 from archaeoglobus fulgidus, pfam duf98
PDB Compounds: (E:) hypothetical protein

SCOPe Domain Sequences for d2nwie2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nwie2 d.190.1.3 (E:2-160) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
naihrilmttdgsitaiieavtqkkvevetleqkiiradrelaelleidegdevnyrvvy
lrangeiyakaisftplkrlensfredlmradipigkimrkhniearreirwsrveeadl
alakelgiadrrvisrnyniihrgkvliniteffpmerf

SCOPe Domain Coordinates for d2nwie2:

Click to download the PDB-style file with coordinates for d2nwie2.
(The format of our PDB-style files is described here.)

Timeline for d2nwie2: